PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4185_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 300aa    MW: 33362.9 Da    PI: 8.3237
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4185_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89e-19143197256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Neem_4185_f_1 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 197
                    788899***********************************************98 PP

2HD-ZIP_I/II125.13.2e-40143232191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Neem_4185_f_1 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 232
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.459139199IPR001356Homeobox domain
SMARTSM003891.0E-15141203IPR001356Homeobox domain
SuperFamilySSF466891.71E-18141207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-17143197IPR009057Homeodomain-like
PfamPF000463.5E-16143197IPR001356Homeobox domain
CDDcd000861.50E-17143200No hitNo description
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PfamPF021835.9E-10199233IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-25199242IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGFDDGCNTG LVLGLGFTAH IETTPSKANL NQIPKRPSLK FDPAVMEATC FEPSLSLGLP  60
GEIYHQTASG AVSRKVNIDM NKGVEESGAA HDQPYRQASP HSAVSSFSSG RVKRERDLSS  120
EEIEVERVSS RVSDEDEDGV NARKKLRLTK EQSALLEESF KQHSTLNPKQ KQALARQLNL  180
RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR RLQKELQELK ALKLAQPLYM  240
HMPAATLTMC PSCERIGGIG DGNSKGPFPM APKPHCYNPF TNPSAAFVKA LLYEACDPSK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047635.11e-163Homeodomain-leucine zipper protein HD4
SwissprotP466041e-107HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061DHW31e-163A0A061DHW3_THECC; Homeodomain-leucine zipper protein HD4
STRINGPOPTR_0007s14590.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-89HD-ZIP family protein